AAGLFQFPRVamide |
AAHLPAEFTTPAVHASLDKFLSNVSTVLTSKYR |
Amblyomma maculatum chemokine binding protein |
||
This cell-penetrating peptide, MASIWVGHRG, is derived from Annexin-3 (Young Kim, 2015). It appears to be more efficient that Tat protein, has low cytotoxicity, is stable in serum, and might be of use as a carrier for the delivery of macromolecular cargos
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |