AG18 |
AG73 peptide |
XPF |
||
[angiogenic peptide 30] AG-30 is a small angiogenic peptide (MLSLIFLHRLKSMRKRLDRKLRLWHRKNYP) that possesses both antimicrobial and pro-inflammatory activities (Nishikawa et al, 2009). AG-30 exhibits antimicrobial activity against various bacteria, induces vascular endothelial cell growth and tube formation in a dose-dependent manner, and increases neovascularization in a Matrigel plug assay. AG-30 up-regulates expression of cytokines and growth factors associated with angiogenesis in human aortic endothelial cells. In the ischaemic mouse hind limb, slow-release AG-30 treatment increases angiogenic
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |