AIM |
AIM2 |
MSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPT |
||
[Absent in melanoma 1 protein] In databanks this protein is known also as CRYBG1 [Beta/gamma crystallin domain-containing protein 1] or ST4 [Suppression of Tumorigenicity 4]. AIM1 has been identified by Ray et al (1996) owing to its altered expression in association with tumor suppression in a human melanoma model. It may act as a tumor suppressor in melanoma cells (Ray et al, 1997), but its role as a tumor suppressor is not clear.
AIM1 methylation has been associated with nasopharyngeal carcinoma and primary tumor invasion of bladder cancer (Brait et al, 2008; Loyo et al, 2011). AIM1 promoter hypermethylation
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |