ASHLPSDFTPAVHASL |
Asingle spermatogonia |
Nef-associated factor-1-beta |
||
[Aldosterone Secretion Inhibitory Factor] This factor (ALRGPKMMRDSGCFGRRLDRIGSLSGLGCNVLRRY) has been identified by De Lean et al (1985) in acid extracts of bovine adrenal medulla. ASIF inhibits PGE1-stimulated secretion of aldosterone from bovine adrenal zona glomerulosa. ASIF is distinct from somatostatin, enkephalin, neuropeptide Y, dynorphin, neurotensin but cross-reacts in a radio-receptor assay for atrial natriuretic factor. The ASIF precursor of 103 amino acids isolated from cultured bovine chromaffin cells contains the bioactive factor at position 69-103 and has been identified as bovine brain natriuretic factor (Nguyen et al, 1989).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |