AURA34 |
AURA46 |
GDQNLQGPMLQGDPGFQRCIDGNVRLVFLFRGKKKKKKG |
||
[augmented in rheumatoid arthritis 43] This is one of a set of genes the expression of which is augmented in bone marrow-derived mononuclear cells from patients with rheumatoid arthritis as compared with bone marrow-derived mononuclear cells from patients with osteoarthritis (Nakamura et al, 2006). The gene in question is identical with Adiponectin receptor-1 (ADIPOR1) (see: adiponectin).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |