adrenomedullin-1 |
Adrenomedullin(8-52) |
HDGF-related protein-3 |
||
abbr. AM2. The approved gene symbol is ADM2. This factor (47 amino acids) has been identified originally as Intermedin (abbr. IMD), a member of protein family including calcitonin and Calcitonin gene-related peptide (Roh et al, 2004). IMD(1-47) (TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY) and a shorter variant of 40 amino acids, termed IMD(8-47) (VGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY), are generated by proteolytic cleavage. Processing of the precursor can also produce IMD(1-53)
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |