COPE Media Kit


Cope Home
Previous entry:
Adrenomedullin binding protein-1
Next entry:
Adrenotensin(163-183)
Random entry:
QGLIPFPRVamide
Search COPE:

Adrenotensin

abbr. ADT. This peptide, (proADM[153-185]) (SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL) corresponds to amino acids 153-185 of the adrenomedullin precursor, from which it is believed to arise by proteolytic cleavage (Gumusel et al, 1995). The cleavage product may act in a modulatory manner to influence vasorelaxation in response to Adrenomedullin (Gumusel et al, 1996).

Zhou et al (2000) have reported that adrenotensin effects are inhibited by Adrenomedullin and that adrenotensin decreases adrenomedullin release rates. Xue et al (2009) have reported that adrenotensin promotes proliferation of renal mesangial cells and also increases TGF-beta-1 and collagen type 4 ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: October 2017



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=1559