aminoacyl tRNA synthetase complex interacting multifunctional protein 3 |
amino-incretins |
DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPLRPPFMVG |
||
[Aminoacyl-tRNA synthetase]
Aminoacyl tRNA-synthetases (also simply tRNA synthetases) are ubiquitously expressed and play an essential role in protein synthesis in all cell types by charging tRNAs with the cognate amino acid, producing aminoacyl-tRNAs that read codons to translate messenger RNAs into proteins (Carter, 1993 Ibba and Söll, 2000). Most aminoacyl-tRNA synthetases can also produce dinucleotide polyphosphates in a variety of physiological conditions, which can function as second messengers both extra- and intra-cellularly (for overview see Tshori et al, 2014).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |