ARAP |
Arasin 2 |
GRP17 |
||
This proline-arginine-rich antimicrobial peptide of 37 amino acids (SRWPSPGRPRPFPGRPKPIFRPRPCNCYAPPCPCDRWRH) has been isolated from hemocyte extracts of the small spider crab, Hyas araneus. Arasin 1, and a putative isoform named arasin 2, are expressed mainly in hemocytes (Stensvåg et al, 2008).
Arasin 1 has a chimeric structure with an N-terminal domain rich in proline and arginine and a C-terminal domain containing two disulfide linkages. For peptides related to arasin 1 see also: arasin-likeSp, GRPSp, callinectin.
Synthetic arasin 1 shows antibacterial activity.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |