BRC canopy cells |
BRE |
RRCICTTRTCRFPYRRLGTCIFQNRVYTFCC |
||
[BRCT domains]
The acronym for this evolutionarily conserved protein-protein interaction motif of approximately 95 amino acids is derived from BRCA1 C-terminus, BRCA1 being a breast cancer suppressor protein. The C-terminal BRCT domain of BRCA1 binds to the central domain of the p53 tumor suppressor, allowing BRCA1 to function as a coactivator of p53.
This protein domain comprises a four-stranded parallel beta-sheet surrounded by three alpha-helices, which form an autonomously folded domain (Zhang et al, 1998). It is found predominantly in proteins involved in DNA repair, recombination and cell cycle control. The domain is found in DNA repair proteins, including DNA
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |