COPE Media Kit


Cope Home
Previous entry:
Brain lipid-binding protein
Next entry:
brain macrophages
Random entry:
HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR
Search COPE:

Brain Lymphatic Endothelial Cells

abbr. BLECs. This cell type was described originally as a non-lumenized endocytic cell type of lymphatic developmental origin and molecular expression that resides in the zebrafish meninges (Bower et al, 2017; Van Lessen et al, 2017; Venero Galanternik et al, 2017). It is found also in the brains of mice, and morphologically similar cells co-expressing the same markers are found also in human post-mortem leptomeninges (Shibata-Germanos et al, 2020). The cells reside in close proximity to blood vessels expressing TIE-2, do not associate with vessels that have penetrated into the brain, and are characterised by the expression of VEGFR3. They express the lymphatic markers MRC1 ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: December 2019



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=6489