Bursal peptide-1 |
Bursal peptide-3 |
AHHFGKEFTPPVQAAYQKVVAGVANALAHKYH |
||
[bursal peptide II]; abbr. BP-2; BP-II. This bioactive peptide (DRATHGGE; Asp-Arg-Ala-Thr-His-Gly-Gly-Glu) has been identified by Liu XD et al (2013) on the bursa of Fabricius, the central humoral immune organ unique to birds which plays important roles in B-lymphocyte differentiation. The peptide is one of several other bursal peptides and promotes colony-forming units for pre-B-cell formation and regulates B-cell differentiation. The peptide has immunomodulatory activities and influences Th1 cell and
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |