bursal septpeptide 2 |
burs-beta |
QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW |
||
abbr. BTP. This peptide, RRL, has been isolated by Feng et al (2012) from the chicken bursa of Fabricius, the central humoral immune organ unique to birds which plays important roles in B-lymphocyte differentiation. The peptide, which is one of several other bursal peptides, has immunomodulatory activity on B-cell antibody and cytokine production.
For other entries pertaining to peptides that are usually not classified as cytokines or growth factors but that possess activities of cytokines see also: regulatory peptide factors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |