COPE Media Kit


Cope Home
Previous entry:
CFH
Next entry:
CFIRNCPKGamide
Random entry:
QAFQTFKPDWNKIRYDAMKMQTSLGQMKKRFNL
Search COPE:

C-fibers

this term - also C-nociceptors - pertains to peripherally localized small diameter bundles of afferent sensory neurons with unmyelinated axons that are separated from one another by the cytoplasm of unmyelinated Schwann cells, forming what is known as Remak bundles. These fibers show low conduction velocity, and the activation of C-fibers by these stimuli leads to a longer-lasting sensation of pain (for overview see: Woolf and Ma, 2007; Dubin and Patapoutian, 2010). These fibers are said to be polymodal, i.e., they often respond to combinations of thermal, mechanical, and chemical stimuli (Kumazawa T, 1996). See also: A-fibers, some of which are involved also in processing of pain information.

The development of diverse subpopulations of cutaneous C-fibers , including VGLUT3(+) low-threshold c-mechanoreceptors, MrgprD(+) polymodal ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: June 2020



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=9763