CCR2B |
CCR4 |
HSHACTSYWCGKFCGTASCTHYLCRVLHPGKMCACVHCSR |
||
[CCR3(+), CCR3(-)]
[CC-Chemokine receptor 3] Old designation CC-CKR3, Eotaxin receptor. Also known as CMKBR3 (chemokine-beta receptor 3). This receptor has been described previously as MIP-1-alpha RL2 (MIP-1-alpha receptor-like-2). In the nomenclature of CD antigens this protein has been given the designation is CD193.
This seven transmembrane-spanning G-protein-coupled receptor is expressed on eosinophils, basophils, dermal dendrocytes, and possibly also on thymocytes and endothelial cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |