CD18/CD11c |
CD19(+) CD25(+) B-cells |
EMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQC |
||
[CD19(+), CD19(-), CD19(high), CD19(low), CD19(int)]
Other designations:
CVID3 [common variable immunodeficiency 3]
This antigen is expressed on B-cells and is considered the hallmark of cells of the B-cell lineage. Lymphocytes immunophenotyped as CD19(+) lymphocytes are, therefore, B-cells. Additional markers can be used to distinguish between different levels of maturation in these cell populations. CD19 is expressed on normal B-cells, a variety of B-cell lymphomas and leukemias but it is not found on
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |