CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP |
CHTM1 |
Short palate lung and nasal epithelium carcinoma-associated protein 2 |
||
[choline transporter-like protein 1] The gene encoding CTL1 was cloned originally as a suppressor for a yeast choline transport mutation from a Torpedo electric lobe yeast expression library by functional complementation (O'Regan et al, 2000). These authors also cloned the homologous rat gene and demonstrated strong expression in motor neurons and oligodendrocytes and to a lesser extent in various neuronal populations throughout the rat brain.
This transmembrane protein has been implicated in choline transport for phospholipid synthesis. Splice variants of the human gene, designated
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |