CIIRNCPRGamide |
CIKNGNGCQPDGSQGNCCSRYCHKEPGWVAGYCR |
Ponericin-L1 |
||
[CIKs]
[Cytokine induced killer cells] These cells are generated in vitro by culturing human peripheral blood mononuclear cells in the presence of IFN-gamma, anti-CD3 monoclonal antibody, IL1, and IL2. The timing of IFN-gamma treatment is critical and optimal results are obtained when IFN-gamma is added before IL2 treatment. CIK cells depend on exogenous cytokines such as IL2, IL7 or IL12 for proliferation.
The majority of CIK effector cells have a T-cell phenotype and resemble
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |