CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK |
Cilia- and flagella-associated protein 299 |
oscillator neurons |
||
[colony-inhibiting lymphokine] This biochemically uncharacterized factor of 85 kDa is produced by a human T-cell hybrid clone. It blocks the growth of granulocytic-monocytic (CFU-GM) or erythroid lineage cells (BFU-E and CFU-E) in a colony formation assay (see also: hematopoiesis). Expression of HLA-DR surface antigens is required on the target cells. Such cells cease dividing after a few days of culture in the presence of CIL, whereas cells not expressing HLA-DR are completely unaffected
For other entries pertaining to hematopoiesis see also the Hematology Dictionary
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |