CLM6 |
CLM8 |
GVSKVKEAMAPKHKEMPFPKYPVEPFTESQ |
||
[CMRF35-like molecule-7] This murine receptor is a member of a larger family of activating and inhibitory receptors. See also: CLM1, CLM2, CLM3, CLM4, CLM5, CLM6, CLM8, CLM9. The gene has been cloned by Yamanishi et al (2008) and it is identical with LMIR5 [leukocyte mono-Ig-like receptor 5].
In the nomenclature of CD antigens the receptor has been given the designation CD300LB.
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |