CM |
CM15 |
Asp-Pro-Gly-Phe-Ser-Ser-Trp-Gly |
||
The antibacterial peptide CM4 (ABP-CM4), isolated from Chinese Bombys mori, is a 35-residue cationic, amphipathic alpha-helical peptide (RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI) belonging to the family of Cecropins. The peptideis a defense peptide that exhibits a broad range of antimicrobial activity. The purified of recombinant peptide has antimicrobial activities against Escherichia coli K, Penicillium chrysogenum, Aspergillus niger, and Gibberella saubinetii (Li et al, 2007). CM4 inhibits the growth of conidia of Fusaricum moniliforme (Xu and Zhuang, 2001).
Zhang et al (2008) have reported that this peptide
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |