CPS-5 |
C-PTH |
GWKDWLKKGKEWLKAKGPGIVKAALQAATQ |
||
[CED3 protease suppressor-6] this gene from Caenorhabditis elegans encodes a homolog of human mitochondrial endonuclease G (endoG).
The CPS-6 protein localizes to mitochondria. Its endonuclease activity is capable of inducing the generation of an apoptotic DNA ladder in isolated Hela cell nuclei. Mouse endoG can substitute the functions of CPS-6 in Caenorhabditis elegans.
CPS-6 appears to act in the same pathway than another cell death gene, WAH-1, and has been shown to physically interact with WAH-1. In vivo, co-expression of WAH-1
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |