CRF2-8 |
CRF-41 |
GWKIGKKLEHMGQNIRDGLISAGPAVFAVGQAATIYAAAK |
||
[cytokine receptor family 2 member 9] CRF2-9 is a member of the type 2 cytokine receptor family. CRF2-9 is the long subunit of the IL22 receptor (Kotenko et al, 2001; Xie et al, 2000). Another designation is ZcytoR11. The approved gene symbol is IL22RA1 [interleukin-22 receptor-alpha-1; IL22R-alpha-1].
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |