CSN2 |
CSN10 |
CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK |
||
(approved gene symbol) [casein-kappa; Kappa-casein]; abbr. or databank synonyms also: CASK, CSN10, CSNK, KCA. See: caseins.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |