CVN2 |
CVS(175-203) |
ADEEDKSQVPLVRVRRGFGCPFNQYQCHSHCLSIGRRGGYCGGSFKTTCTCYN |
||
This peptide has been identified as a tumor homing peptide for melanoma cells (Matsuo et al, 2011). It has been used to target endothelial cells in xenotransplanted melanoma cells and is effective in delaying tumor growth and increasing animal survival (see: K237 peptide).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |