CASMC |
casokinins |
Kisspeptin-10 |
||
This antibacterial peptide has been isolated from bovine milk (Zucht et al, 1995). Casocidin-1 is a peptide of 39 amino acids and has been shown to be a fragment of bovine alpha-s2-casein (KKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPY) and corresponds to alpha-s2-casein(165-203). (note: in some publications the fragment is rendered as casein-alpha-s2(150-188).
Casocidin-1 inhibits the growth of Escherichia coli and Staphylococcus carnosus.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |