Cerebral vascular amyloid peptide |
Cerebroglycan |
ACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT |
||
This neuropeptide (NGGTADALYNLPDLEKIamide) has been identified in the cerebral ganglion of the marine mollusk Aplysia californica. The cerebrin cDNA encodes an 86 amino acid prohormone that predicts cerebrin and one additional peptide. Cerebrin-like immunoreactivity is present also in Lymnaea stagnalis suggesting that cerebrin-like peptides may be widespread throughout gastropoda.
Cerebrin has a profound effect on the feeding motor pattern, dramatically shortening the duration of the radula protraction, mimicking motor-pattern alterations observed in food-induced arousal states.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |