Coronavirus 7a protein |
Coronavirus E protein |
AAHLPAEFTTPAVHASLDKFLSNVSTVLTSKYR |
||
[Coronavirus E protein; SARS-CoV E protein; severe acute respiratory syndrome coronavirus E protein; CoV E protein]
The coronavirus E protein is a very small protein present in low amounts in virus particles. E protein is important for virus assembly in some corona viruses but dispensible in others (Lim and Liu, 2001; Kuoand Masters, 2003), but its deletion lowers virus titers and morphologically aberrant or immature virions that are replication-competent but propagation-defective (Ortego et al, 2007; DeDiego et al, 2007). In infected cells, E protein is located as an integral membrane protein in the Golgi or ER-Golgi intermediate compartment (Corse and Machamer, 2000; Cohen et al, 2011; Nieto-Torres et al, 2011).
Coronavirus E protein
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |