COPE Media Kit


Cope Home
Previous entry:
Cytomegalovirus UL82 protein
Next entry:
Cytomegalovirus UL111a protein
Random entry:
SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA
Search COPE:

Cytomegalovirus UL83 protein

[CMV UL83 protein] abbr. also: pUL83. This protein, known also as Cytomegalovirus phosphoprotein pp65 (Cytomegalovirus pp65; CMV pp65; pp65 (ppUL83), is the most abundant virus matrix component (Varnum et al, 2004).

The protein from human CMV has been shown to be required for the incorporation of other viral proteins into the virion (Chevillotte et al, 2009; Reyda et al, 2014; and its absence impairs growth in monocytes and macrophages (Chevillotte et al, 2009). McGregor et al (2004) have reported that guinea pig CMV lacking the UL83 homolog ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: July 2015



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=13875