Cytomegalovirus UL82 protein |
Cytomegalovirus UL111a protein |
SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA |
||
[CMV UL83 protein] abbr. also: pUL83. This protein, known also as Cytomegalovirus phosphoprotein pp65 (Cytomegalovirus pp65; CMV pp65; pp65 (ppUL83), is the most abundant virus matrix component (Varnum et al, 2004).
The protein from human CMV has been shown to be required for the incorporation of other viral proteins into the virion (Chevillotte et al, 2009; Reyda et al, 2014; and its absence impairs growth in monocytes and macrophages (Chevillotte et al, 2009). McGregor et al (2004) have reported that guinea pig CMV lacking the UL83 homolog
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |