COPE Media Kit


Cope Home
Previous entry:
EASPRVSRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG
Next entry:
Easter
Random entry:
TPHWRPQGRFamide
Search COPE:

EAST

[epidermal growth factor receptor-associated protein with SH3 and TAM domains]. The protein is the same as STAM-2 [signal-transducing adaptor molecule-2].

This cytoplasmic chicken protein of 68 kDa contains a src homology domain-3 domain in its midregion and a tyrosine-based activation motif in its COOH terminus (Lohi et al, 1998). The protein is present in most chicken tissues. The protein interacts with the EGF receptor in an EGF dependent manner and become tyrosine-phosphorylated by the receptor.

EAST is probably involved in EGF signaling and in the endocytotic machinery as it has been shown to interact with eps15, an EGF receptor ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: March 2003



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=16130