EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA |
EVN |
metalloelastase |
||
This is a databank synonym for Ectromelia virus A39R protein. See: A39R.
For other relevant entries see also the Pathogenicity/Virulence Factors Dictionary section of this encyclopedia.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |