fan cells |
FAP |
MFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK |
||
[fibronectin type 3 and ankyrin repeat domain protein 1] This protein of 345 amino acids contains a fibronectin type III domain in the N terminus and 5 ankyrin repeats in the C terminus. The protein is highly conserved in vertebrate species. It has been identified by Zheng et al (2007). The protein appears to be expressed in a testis-specific manner (pachytene spermatocytes and spermatids) and the authors have suggested a role in late-meiotic or postmeiotic processes.
Wang et al (2010) have reported that FANK1 functions as an anti-apoptotic protein that activates the AP-1 pathway and endogenous jun. FANK1 inhibits cell death by apoptosis
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |