immulectin-5 |
immulectin-V |
DLRFLYPRGKLPVPTPPPFNPKPIYIDMGNRY |
||
Immulectins have been isolated from the tobacco hornworm, Manduca sexta. All proteins belong to the family of C-type lectins and contain two tandem carbohydrate recognitions domains. These lectins are involved in immune responses.
Immulectin-1 (abbr. IML-1) (309 amino acids) (Yu et al, 1999) synthesis in the fat body is induced by injection of killed Gram-positive or Gram-negative bacteria or yeast. The protein is found in the hemolymph. Addition of recombinant Immulectin-1 to M. sexta plasma stimulates activation of phenol oxidase, a key
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |