COPE Media Kit


Cope Home
Previous entry:
IVSYPDDAGEHAHKMGamide
Next entry:
IWDAIFHGAKHFLHRLVNPGGKDAVKDVQQKQ
Random entry:
casein-alpha-s1(174-184)
Search COPE:

Ivy cells

This type of interneurons, named after their dense and fine axons innervating mostly basal and oblique pyramidal cell dendrites, has been described by Fuentealba et al (2008). The cells are GABAergic neurons found in the cerebral cortex, express the neuronal isoform of nitric oxide synthase, neuropeptide Y, and high levels of GABA(A) receptor alpha-1 subunit, and regulate the excitability of pyramidal cell dendrites through slowly rising and decaying GABAergic inputs. Krook-Magnuson et al (2011) have reported that Ivy cells display the phenomenon of persistent firing, a state of continued firing in the absence of continued input, and that induction of persistent firing is inhibited by mu opioid receptor activation.

... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: June 2017



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=28079