KND peptide |
KNECLWTDMLSNFGYPGYQSKHYACIRQKG |
SGADFYPWGamide |
||
[KNDy neuron]
[kisspeptin/neurokinin B/dynorphin neurons] also: Arcuate Kiss1 neurons. This term refers to a subpopulation of neurons located within the arcuate nucleus of the hypothalamus. They express the three neuropeptides kisspeptin, neurokinin B (NKB), and dynorphin. These neurons form a neural network upstream of GNRH neurons (for overview see: Borsay et al, 2014) and play a key role in the regulation of fertility, regulating estrous cyclicity through pulsatile release of GNRH [gonadotropin releasing hormone] and luteinizing hormone
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |