KPSSPPEEamide |
KPWNFFKEIERAVARTRDAVISAGPAVATVAAASAVASG |
Mirabilis jalapa antimicrobial peptides |
||
This short tripeptide (Lys-Pro-Val) corresponds to alpha-MSH(11-13), the C-terminal end of alpha-MSH (see: POMC).
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |