Lkn-1 |
LKRWGTIKKSKAINVLRGFRKEIGRMLNILNRRRR |
extraintestinal pathogenic Escherichia coli |
||
[Leukophysin] LKP is a protein of 28 kDa present in granulated CD8(+) and CD4(+) cytotoxic T-cells. LKP is found in granules that do not contain granzyme A. A cDNA has been cloned by Abdelhaleem et al (1996). LKP lacks typical RNA-binding domains but is identical to the C-terminus of DDX9 and is most likely a splice variant of DDX9 (see: DHX9 [DEAH box protein 9]. For a role in innate immunity see: DHX9.
Information about proteins/peptides with antimicrobial activities involved in innate immunity as well as other proteins involved can be found in the
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |