COPE Media Kit


Cope Home
Previous entry:
lycat
Next entry:
LycCC2
Random entry:
VPSPGSSEDDLQEEEQLEQAIKEHLGQGSSQEMEKLAKVS
Search COPE:

LycCC

[large yellow croaker CC-Chemokine] This protein (78 amino acids) is a CC-Chemokine isolated from large yellow croaker (Pseudosciaena crocea). The protein is highly chemotactic for peripheral blood leukocytes. The LycCC gene is expressed constitutively but at different levels in many tissues. Upon stimulation with poly(I:C) or inactivated trivalent bacterial vaccine, LycCC gene expression is upregulated in kidney, gills, spleen, liver, intestine, blood, and heart. In vivo administration of LycCC significantly upregulates the expression of low molecular mass polypeptide 10 (LMP10), MHC class I alpha chain and Beta-2-Microglobulin. Thus, LycCC may not only have a pro-inflammatory ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: January 2013



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=31514