MED19 |
Medea |
AAHLPAEFTTPAVHASLDKFLSNVSTVLTSKYR |
||
[mesenteric oestrogen-dependent adipose gene-7] Human and mouse MEDA-7 have been cloned by Zhang et al (2011). The proteins have six conserved cysteine residues, like many cytokines. MEDA-7 is an adipokine expressed in adipose tissues. MEDA-7 is expressed predominantly in the stromal-vascular cell fraction. In this fraction, pro-inflammatory M1 macrophages are rich in MEDA-7.
Meda-7 is downregulated in mesenteric adipose tissue of female knock-out mice lacking expressen of the follicle-stimulating hormone receptor at 5 months (obese
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |