Mgca |
MGDF |
ADA1 |
||
[Mytilus galloprovincialis defensin-1]; often referred to as mussel defensin. This peptide of 38 amino acids (GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC) belongs to the family of defensins. The peptide contains 8 cysteine residues (all of which are involved in disulfide bonding) (Yang et al, 2000), a modified hydroxylated tryptophan residue in position 28, and is processed from a longer precursor expressed in hemocytes (Mitta et al, 1999; Hubert et al, 1996).
MGD-1 has been isolated from the hemolymph of the Mediterranean mussel Mytilus galloprovincialis immunized by injection with bacteria. The peptide is active against Gram-positive bacteria and Gram-negative bacteria but it is not cytotoxic for
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |