MLKAHLIFSTPLTISLFDCATWRPYLQTEYYDVMTVISPPEFG |
MLKLIFLHRLKRMRKRLKRKLRLWHRKRYK |
Exendin-3 |
||
[Mixed lineage kinase domain-like; mixed lineage kinase domain like pseudokinase] MLKL, a kinase-dead kinase, has been identified as a critical critical component of the necrosome, a protein complex containing RIP1 and RIP3 that plays a role in programmed necrosis signaling (Sun et al, 2012; Wang et al, 2012). MLKL is phosphorylated by RIP3, and is critical for programmed necrosis. Necrosulfonamide specifically blocks necrosis downstream of RIP3 activation. Zhao et al. (2012) have reported that knock-down of MLKL expression confers resistance to programmed necrosis induced by TNF-alpha
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |