Mrgprc11 |
MRGPRX1 |
ALRGPKMMRDSGCFGRRLDRIGSLSGLGCNVLRRY |
||
[MAS-related GPR member D; Mas-related G-protein-coupled receptor member D], referred to also as MRGD. The MRGPRD receptor (Takeda et al, 2002) is a member of a larger family of G-protein-coupled rerceptors sharing high sequence homology with the Mas oncogene (Dong et al, 2001).
Zylka et al (2003) have reported strong expression of the receptor in newborn and adult dorsal root ganglia and trigeminal ganglia. Neurons expressing the receptor usually also express RET but, depending on the species, they may or may not express the capsaicin receptor VR1. Coexpression of MRGPRD and another family member, MRGA, appear to define a single cell type in
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |