MSK39 |
MSKLVQAISDAVQAGQNQDWAKLGTSIVGIVENGVGILGKLFGF |
Trm |
||
This peptide corresponds to PSM-beta [Phenol soluble modulin beta] see: Modulins.
For other relevant entries see also the Pathogenicity/Virulence Factors Dictionary section of this encyclopedia.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |