man-6-P/IGF-2 receptor |
mandibular organ-inhibiting hormone |
KAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF |
||
This biochemically uncharacdterised inhibitor has been identified in saline extract from normal bone marrow cells. The inhibitor protects rapidly proliferating hematopoietic spleen colony-forming cells (see also: CFU) from the lethal effects of large doses of tritiated thymidine. This extract is non-toxic to the cells and is not found in regenerating marrow where the population of colony-forming cells is rapidly proliferating. The extract/inhibitor has no effect on the proliferation of granulocytic precursor cell, and no effect on the average cytoplasmic structuredness of the whole bone marrow cell population (Lord et al, 1976). It is thought that this inhibitor is the same as SCI [stem cell inhibition factor, stem cell inhibitor
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |