Mytimacins |
MytM |
GIWSSIKNLASKAWNSDIGQSLRNKAAGAINKFVADKIGVTPSQAAS |
||
abbr. MytM. Mytimycin is a strictly antifungal peptide from the blue mussel, Mytilus edulis. Mytimycin identified in Mytilus galloprovincialis is a secreted protein of 54 amino acids thought to play a role in innate immunity (Sonthi et al, 2011).
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |