Neuropilin-2 |
Neuropoietins |
SPIEPKGEILHRFRRSFCDYNLCVVSCKDSGFIGGYCSELDLCSCTIGWQ |
||
abbr. NP; to avoid confusion see also: Neuropoietins. This protein is known also as cardiotrophin-2 (approved gene symbol: CTF2; abbr. also: CT-2).
The gene encoding murine neuropoietin has been identified by Derouet et al (2004). It is localized in tandem with the cardiotrophin-1 gene on mouse chromosome 7. Neuropoietin is structurally and functionally related with CNTF, cardiotrophin-1, and cardiotrophin-like cytokine. High expression of Neuropoietin is observed in embryonic neuroepithelial cells. Expression is seen also in the retina and, to a lesser extent, in skeletal muscle. In vitro, Neuropoietin is a survival factor
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |