Neutrophil antibiotic peptide NP2 |
Neutrophil antibiotic peptide NP-3B |
KKTCIVHKMKKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGL |
||
abbr. NP-3A. This is an alternative designation for rabbit Corticostatin 1. See: Corticostatins.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
For other entries pertaining to peptides that are usually not classified as cytokines or growth factors but that possess activities of cytokines see also: regulatory peptide factors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |