PICT-1 |
PIDD |
WES(a) antigen |
||
[Phospholipase A2 Induced DNA fragmentation factor released at 15th min] This protein (MSILPCKNVSIWVIKDTAASDKEVVLGSDRAIKFLYLATG) is secreted by human peripheral lymphocytes when incubated with Naja naja (Indian cobra) venom phospholipase A2 (NV-PLA2). PID15 acts as an apoptosis inducing factor in lymphocytes (see also: AIF) (Chethankumar and Srinivas, 2014).
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |