Peptide 769P |
peptide analogue of thymulin |
Endorphin-gamma |
||
Peptide 3910 (RADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK) has been isolated from pig intestines (Agerberth et al, 1993). It is active against Gram-positive bacteria and Gram-negative bacteria and may thus play a role in innate immunity.
The peptide shows 100 % identity with a sequence from Drosophila melanogaster DROER [Drosophila enhancer of rudimentary] encoded by the CG1871 gene, the product of which regulates the Drosophila rudimentary gene, encoding the CAD protein that combines enzymatic activities of the pyrimidine pathway. DROER is a trans-acting regulator that has been implicated in wing development in the
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |