perilipin 2 |
perineural cells |
retinoic acid induced E |
||
This antimicrobial peptide has been purified from the marine clamworm Perinereis aibuhitensis Grube (Pan et al, 2004). Perinerin is a highly basic and hydrophobic protein of 51 amino acids (FNKLKQGSSKRTCAKCFRKIMPSVHELDERRRGANRWAAGFRKCVSSICRY). It shows marked activity in vitro against both Gram-negative bacteria and Gram-positive bacteria and fungi. Perinerin appears to be expressed constitutively.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |